PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G157300.1
Common NamePHAVU_004G157300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CO-like
Protein Properties Length: 407aa    MW: 46015.4 Da    PI: 4.635
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G157300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.31.4e-071661342
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                        +r C+ + + +++++C  ++ +lC+ C    H+       H++v+l
  Phvul.004G157300.1 16 ARACESCLKVRARWYCAADDAFLCHGCDNMVHSAnqlasrHQRVKL 61
                        578******99*********************66889999999875 PP

2CCT67.73e-23353396144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Phvul.004G157300.1 353 REARVLRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT 396
                         9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.8E-71461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.0821461IPR000315B-box-type zinc finger
PfamPF006432.6E-51661IPR000315B-box-type zinc finger
CDDcd000213.48E-61761No hitNo description
PfamPF062039.6E-18353395IPR010402CCT domain
PROSITE profilePS5101716.063353395IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MNNEMKEASA LGARTARACE SCLKVRARWY CAADDAFLCH GCDNMVHSAN QLASRHQRVK  60
LQTASSKLNY SDTLNHNKKV AWHSGFTRKA RTPRHSTKLQ EQQQKKIHEE GEEEQQQQQV  120
FFNNTISLPL VPELGSEEAL YNDESEEQLL CRVPVFDAEL CSVYNEVKEE VLAGEEVFDL  180
ENFSCEFLPS DMDLAEFAAD VESLLGNGAD EDSSEHVKGS EIVLDCKEED DEMDACVDGV  240
GEKDAMVKVK DEEELDADTS CHLDSIILDM NWNDIVESES LAQEQDKKEM FLRLNYEDVI  300
AAWASQGCPW TTGTPPNFNS DDFLPGFLGS NGEDVLCCYG EMRSLRGHAD GGREARVLRY  360
REKRRTRLFA KKIRYEVRKL NAEKRPRMKG RFVKRTSFLG ATVLPP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1363379RRTRLFAKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152761.10.0hypothetical protein PHAVU_004G157300g
TrEMBLV7C6480.0V7C648_PHAVU; Uncharacterized protein
STRINGGLYMA07G10161.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.13e-89B-box type zinc finger protein with CCT domain